PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0107s0025.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 350aa    MW: 38086.1 Da    PI: 7.4117
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0107s0025.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.83.4e-31189246259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +Dgy+WrKYGqK vk+s++prsYYrCt ++C+vkk+vers edp++v++tYeg+H h+
  Kalax.0107s0025.1.p 189 EDGYRWRKYGQKAVKNSPYPRSYYRCTNTKCTVKKRVERSCEDPTTVITTYEGQHCHQ 246
                          8*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-32173246IPR003657WRKY domain
SuperFamilySSF1182901.57E-27180247IPR003657WRKY domain
PROSITE profilePS5081129.907183248IPR003657WRKY domain
SMARTSM007748.6E-36188247IPR003657WRKY domain
PfamPF031066.3E-24189246IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MDGAREVPER SEPLEYDSLE YDSESRYLFD DMSTTECSIL SEFGWATTSS NLHLHRHRHH  60
HHHQPIDDPF IDFATSSISK SESIGSVRGG GGGGSGLLRF AETPPVTVAA EGNTSCGASR  120
LVEQASTSNP SVSSSSSDQD LAAEKSIGSG ETPPSSLQIP SGKSKKKGQP RIRQPRFAFV  180
TKSEVDHLED GYRWRKYGQK AVKNSPYPRS YYRCTNTKCT VKKRVERSCE DPTTVITTYE  240
GQHCHQIAGF PRGGALSIRG AAFGGQMGPP NSQYYYPGMQ HVPHQSPNSS AAPTPIPTSV  300
TDNEPKEASR MMILSTEPQL PQPASTPQVT SNEGLLGDIV SPRRRNLHP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A7e-261812471076Probable WRKY transcription factor 4
1wj2_A7e-261812471076Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311329.27e-75hypothetical protein POPTR_0008s09360g
SwissprotQ9C9833e-62WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLB9HID08e-75B9HID0_POPTR; Uncharacterized protein
STRINGPOPTR_0008s09360.12e-74(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-60WRKY DNA-binding protein 57